MSX1 Antibody (1D2)


Immunoprecipitation: MSX1 Antibody (1D2) [H00004487-M05] - Analysis of MSX1 transfected lysate using anti-MSX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MSX1 rabbit polyclonal antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IP

Order Details

MSX1 Antibody (1D2) Summary

MSX1 (NP_002439 216 a.a. - 297 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
MSX1 (1D2)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MSX1 Antibody (1D2)

  • Homeobox protein Hox-7
  • homeobox protein MSX-1
  • HOX7
  • HOX7homeobox 7
  • HYD1
  • HYD1msh homeobox homolog 1 (Drosophila)
  • msh (Drosophila) homeo box homolog 1 (formerly homeo box 7)
  • msh homeo box 1
  • msh homeobox 1
  • Msh homeobox 1-like protein
  • msh homeobox homolog 1
  • MSX1
  • OFC5
  • STHAG1


This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for MSX1 Antibody (H00004487-M05) (0)

There are no publications for MSX1 Antibody (H00004487-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSX1 Antibody (H00004487-M05) (0)

There are no reviews for MSX1 Antibody (H00004487-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSX1 Antibody (H00004487-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MSX1 Products

Bioinformatics Tool for MSX1 Antibody (H00004487-M05)

Discover related pathways, diseases and genes to MSX1 Antibody (H00004487-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSX1 Antibody (H00004487-M05)

Discover more about diseases related to MSX1 Antibody (H00004487-M05).

Pathways for MSX1 Antibody (H00004487-M05)

View related products by pathway.

PTMs for MSX1 Antibody (H00004487-M05)

Learn more about PTMs related to MSX1 Antibody (H00004487-M05).

Blogs on MSX1

There are no specific blogs for MSX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MSX1 Antibody (1D2) and receive a gift card or discount.


Gene Symbol MSX1