MST4 Antibody (7H4) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MST4 Primary Antibodies

Order Details


    • Catalog Number
      H00051765-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MST4 Antibody (7H4) [PE] Summary

Immunogen
RP6-213H19.1 (NP_057626, 331 a.a. ~ 416 a.a) partial recombinant protein with GST tag.KKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNA SRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADE S
Localization
Cytoplasmic and Golgi Apparatus
Specificity
RP6-213H19.1 - Mst3 and SOK1-related kinase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MST4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human, Rat.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MST4 Antibody (7H4) [PE]

  • EC 2.7.11
  • EC 2.7.11.1
  • Mammalian STE20-like protein kinase 4
  • mammalian sterile 20-like 4
  • MASK
  • Mst3 and SOK1-related kinase
  • MST-4
  • serine/threonine protein kinase MASK
  • serine/threonine protein kinase MST4
  • Serine/threonine-protein kinase MASK
  • serine/threonine-protein kinase MST4
  • STE20-like kinase MST4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-83024
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00051765-M02PE
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MST4 Antibody (H00051765-M02PE) (0)

There are no publications for MST4 Antibody (H00051765-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MST4 Antibody (H00051765-M02PE) (0)

There are no reviews for MST4 Antibody (H00051765-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MST4 Antibody (H00051765-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MST4 Products

Bioinformatics Tool for MST4 Antibody (H00051765-M02PE)

Discover related pathways, diseases and genes to MST4 Antibody (H00051765-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MST4 Antibody (H00051765-M02PE)

Discover more about diseases related to MST4 Antibody (H00051765-M02PE).
 

Pathways for MST4 Antibody (H00051765-M02PE)

View related products by pathway.

PTMs for MST4 Antibody (H00051765-M02PE)

Learn more about PTMs related to MST4 Antibody (H00051765-M02PE).
 

Research Areas for MST4 Antibody (H00051765-M02PE)

Find related products by research area.

Blogs on MST4

There are no specific blogs for MST4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MST4 Antibody (7H4) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MST4