MSP R/Ron Antibody (4E2.)

Images

 
ELISA: MSP R/Ron Antibody (4E2) [H00004486-M04] - Detection limit for recombinant GST tagged MST1R is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MSP R/Ron Antibody (4E2.) Summary

Immunogen
MST1R (NP_002438, 26 a.a. - 125 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL
Specificity
MST1R (4E2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MST1R
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MSP R/Ron Antibody (4E2.)

  • CD136 antigen
  • CD136
  • CDw136c-met-related tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.1
  • macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
  • MSP R
  • MSP receptor
  • MSPR
  • MST1R
  • p185-Ron
  • Protein-tyrosine kinase 8
  • PTK8 protein tyrosine kinase 8
  • PTK8
  • Ron
  • RONmacrophage-stimulating protein receptor
  • soluble RON variant 1
  • soluble RON variant 2
  • soluble RON variant 3
  • soluble RON variant 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for MSP R/Ron Antibody (H00004486-M04) (0)

There are no publications for MSP R/Ron Antibody (H00004486-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSP R/Ron Antibody (H00004486-M04) (0)

There are no reviews for MSP R/Ron Antibody (H00004486-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MSP R/Ron Antibody (H00004486-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSP R/Ron Products

Bioinformatics Tool for MSP R/Ron Antibody (H00004486-M04)

Discover related pathways, diseases and genes to MSP R/Ron Antibody (H00004486-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSP R/Ron Antibody (H00004486-M04)

Discover more about diseases related to MSP R/Ron Antibody (H00004486-M04).
 

Pathways for MSP R/Ron Antibody (H00004486-M04)

View related products by pathway.

PTMs for MSP R/Ron Antibody (H00004486-M04)

Learn more about PTMs related to MSP R/Ron Antibody (H00004486-M04).
 

Research Areas for MSP R/Ron Antibody (H00004486-M04)

Find related products by research area.

Blogs on MSP R/Ron

There are no specific blogs for MSP R/Ron, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSP R/Ron Antibody (4E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MST1R
Entrez
OMIM
Uniprot