MSP/MST1 Antibody (3B5)

Images

 
Sandwich ELISA: MSP/MST1 Antibody (3B5) [H00004485-M04] - Detection limit for recombinant GST tagged MST1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MSP/MST1 Antibody (3B5) Summary

Immunogen
MST1 (AAH48330, 19 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
Specificity
This product is specific for Human MST1 monoclonal antibody (M04), clone 3B5 [Gene ID: 4485].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MST1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MSP/MST1 Antibody (3B5)

  • D3F15S2
  • EC 3.4.21
  • hepatocyte growth factor-like protein homolog
  • HGFL
  • HGFLhepatocyte growth factor-like protein
  • macrophage stimulating 1 (hepatocyte growth factor-like)
  • Macrophage stimulatory protein
  • Macrophage-stimulating protein
  • MSP
  • MSPDNF15S2
  • MST1
  • NF15S2
  • SF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF691
Species: Hu
Applications: WB, IP, Block
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56552
Species: Hu
Applications: WB
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6798
Species: Hu
Applications: WB, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
H00004485-M04
Species: Hu
Applications: ELISA

Publications for MSP/MST1 Antibody (H00004485-M04) (0)

There are no publications for MSP/MST1 Antibody (H00004485-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSP/MST1 Antibody (H00004485-M04) (0)

There are no reviews for MSP/MST1 Antibody (H00004485-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MSP/MST1 Antibody (H00004485-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSP/MST1 Products

Bioinformatics Tool for MSP/MST1 Antibody (H00004485-M04)

Discover related pathways, diseases and genes to MSP/MST1 Antibody (H00004485-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSP/MST1 Antibody (H00004485-M04)

Discover more about diseases related to MSP/MST1 Antibody (H00004485-M04).
 

Pathways for MSP/MST1 Antibody (H00004485-M04)

View related products by pathway.

PTMs for MSP/MST1 Antibody (H00004485-M04)

Learn more about PTMs related to MSP/MST1 Antibody (H00004485-M04).
 

Research Areas for MSP/MST1 Antibody (H00004485-M04)

Find related products by research area.

Blogs on MSP/MST1

There are no specific blogs for MSP/MST1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSP/MST1 Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MST1
Entrez
Uniprot