MSK1/RPS6KA5 Recombinant Protein Antigen

Images

 
There are currently no images for MSK1/RPS6KA5 Protein (NBP1-82618PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MSK1/RPS6KA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPS6KA5.

Source: E. coli

Amino Acid Sequence: RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPS6KA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82618.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MSK1/RPS6KA5 Recombinant Protein Antigen

  • EC 2.7.11
  • MGC1911,90 kDa ribosomal protein S6 kinase 5
  • MSK1
  • MSK1EC 2.7.11.1
  • MSPK1
  • Nuclear mitogen- and stress-activated protein kinase 1
  • ribosomal protein S6 kinase alpha-5
  • ribosomal protein S6 kinase, 90kD, polypeptide 5
  • ribosomal protein S6 kinase, 90kDa, polypeptide 5
  • RLPK
  • RPS6KA5
  • RSKL
  • RSK-like protein kinase
  • S6K-alpha-5

Background

MSK-1 is a mitogen and stress activated protein kinase-1 which belongs to the AGC family of kinases and is related in structure to the ribosomal p70 S6 kinase subfamily. MSK-1can be activated by ERK1/2 and SAPK2 /p38 MAP kinase. It is also known to be required for the phosphorylation of CREB, ATF1 H3 and HMG-14 in response to mitogen and stress (1-2). Similar to RSK, MSK-1 contains two kinase domains (N-term and a C-term) (3). Once phosphorylated on Thr581 and Ser360 by ERK1/2 and SAPK2/p38, MSK-1 autophosphorylate on at least 5 sites. Of these autophosphorylation sites Ser212 and Ser376 get phosphorylated by the C-terminal kinase domain of MSK-1 which is essential for the catalytic activity of the N-terminal kinase domain (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF189
Species: Hu, Mu
Applications: IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20237
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB79671
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-82618PEP
Species: Hu
Applications: AC

Publications for MSK1/RPS6KA5 Protein (NBP1-82618PEP) (0)

There are no publications for MSK1/RPS6KA5 Protein (NBP1-82618PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSK1/RPS6KA5 Protein (NBP1-82618PEP) (0)

There are no reviews for MSK1/RPS6KA5 Protein (NBP1-82618PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MSK1/RPS6KA5 Protein (NBP1-82618PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSK1/RPS6KA5 Products

Research Areas for MSK1/RPS6KA5 Protein (NBP1-82618PEP)

Find related products by research area.

Blogs on MSK1/RPS6KA5

There are no specific blogs for MSK1/RPS6KA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MSK1/RPS6KA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA5