MSH6 Antibody (1F2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MSH6 Primary Antibodies

Order Details


    • Catalog Number
      H00002956-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MSH6 Antibody (1F2) [PE] Summary

Immunogen
MSH6 (NP_000170 931 a.a. - 1030 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
Specificity
MSH6 - mutS homolog 6 (E. coli)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MSH6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MSH6 Antibody (1F2) [PE]

  • DNA mismatch repair protein Msh6
  • G/T mismatch-binding protein
  • GTBPHNPCC5
  • GTMBP
  • hMSH6
  • HSAP
  • mutS (E. coli) homolog 6
  • mutS homolog 6 (E. coli)
  • MutS-alpha 160 kDa subunit
  • p160
  • sperm-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56552
Species: Hu
Applications: WB
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56554
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-58368
Species: Hu
Applications: ICC/IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MSH6 Antibody (H00002956-M01PE) (0)

There are no publications for MSH6 Antibody (H00002956-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSH6 Antibody (H00002956-M01PE) (0)

There are no reviews for MSH6 Antibody (H00002956-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MSH6 Antibody (H00002956-M01PE). (Showing 1 - 1 of 1 FAQ).

  1. I am testing a mouse sample with human xenograft for GBM and I am looking for an MSH6 Antibody that will only detect the human cells.
    • Currently, we have no validation that any of our MSH6 antibodies will not cross react with mouse. All of our MSH6 Antibodies are raised against Human MSH6 so we have checked the % homology with mouse MSH6 which has come to be 85%. As 85% is very high, the chances of the antibody detecting the mouse tissue as well as the human tissue are high.

Secondary Antibodies

 

Isotype Controls

Additional MSH6 Products

MSH6 H00002956-M01PE

Bioinformatics Tool for MSH6 Antibody (H00002956-M01PE)

Discover related pathways, diseases and genes to MSH6 Antibody (H00002956-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSH6 Antibody (H00002956-M01PE)

Discover more about diseases related to MSH6 Antibody (H00002956-M01PE).
 

Pathways for MSH6 Antibody (H00002956-M01PE)

View related products by pathway.

PTMs for MSH6 Antibody (H00002956-M01PE)

Learn more about PTMs related to MSH6 Antibody (H00002956-M01PE).
 

Research Areas for MSH6 Antibody (H00002956-M01PE)

Find related products by research area.

Blogs on MSH6

There are no specific blogs for MSH6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSH6 Antibody (1F2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MSH6