MSH2 Antibody (4F11)

Images

 
Western Blot: MSH2 Antibody (4F11) [H00004436-M04] - Analysis of MSH2 expression in transfected 293T cell line by MSH2 monoclonal antibody (M04), clone 4F11. Lane 1: MSH2 transfected lysate (Predicted MW: 104.7 KDa). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MSH2 Antibody (4F11) Summary

Immunogen
MSH2 (AAH21566 835 a.a. - 934 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MSH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MSH2 Antibody (4F11)

  • COCA1
  • DNA mismatch repair protein Msh2
  • FCC1
  • hMSH2
  • HNPCC
  • HNPCC1
  • HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1)
  • LCFS2
  • MSH2
  • mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
  • MutS protein homolog 2

Background

MSH2 is a 100 kDa nuclear antigen and encodes a protein of 934 amino acids. The MSH2 gene is one of 4 known genes encoding proteins involved in the rapair of mismatch nucleotides following DNA replications or repair. Mutations in the NSH2 gene contribute to the development of sporadic colorectal carcinoma. MSHS mutations are responsible for 50% of inherited non-polyposis colorectal (HNPCC). The repair of mismatch DNA is essential to maintaining the integrity of genetic information over time. An alteration of microsatellite repeats is the result of slippage owing to strand misalignment during DNA replication and is referred to as microsatellite instability (MSI). These defects in DNA repair pathways have been related to human carcinogenesis. MSH-2 is involved in the intial cognition of mismatch nucleotides during the replication mismatch repair process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56552
Species: Hu
Applications: WB
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-56554
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58368
Species: Hu
Applications: ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB2476
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-16391
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF

Publications for MSH2 Antibody (H00004436-M04) (0)

There are no publications for MSH2 Antibody (H00004436-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSH2 Antibody (H00004436-M04) (0)

There are no reviews for MSH2 Antibody (H00004436-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSH2 Antibody (H00004436-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSH2 Products

Bioinformatics Tool for MSH2 Antibody (H00004436-M04)

Discover related pathways, diseases and genes to MSH2 Antibody (H00004436-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSH2 Antibody (H00004436-M04)

Discover more about diseases related to MSH2 Antibody (H00004436-M04).
 

Pathways for MSH2 Antibody (H00004436-M04)

View related products by pathway.

PTMs for MSH2 Antibody (H00004436-M04)

Learn more about PTMs related to MSH2 Antibody (H00004436-M04).
 

Research Areas for MSH2 Antibody (H00004436-M04)

Find related products by research area.

Blogs on MSH2

There are no specific blogs for MSH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSH2 Antibody (4F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MSH2
Entrez
Uniprot