We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human MRS2 GST (N-Term) Protein

Images

 
Recombinant Human MRS2 Protein [H00057380-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human MRS2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-117 of Human MRS2L

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MRS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRS2 GST (N-Term) Protein

  • HPT
  • MGC78523
  • mitochondrial
  • MRS2 magnesium homeostasis factor homolog (S. cerevisiae)
  • MRS2-like protein
  • MRS2-like, magnesium homeostasis factor (S. cerevisiae)
  • MRS2-like, magnesium homeostasis factor

Background

MRS2L( AAH01028, 1 a.a. - 118 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
NBP2-95244
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-16700
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
7570-GH
Species: Hu
Applications: EnzAct
AF4709
Species: Mu
Applications: IP, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-38770
Species: Hu
Applications: WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
H00057380-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for MRS2 Recombinant Protein (H00057380-P01) (0)

There are no publications for MRS2 Recombinant Protein (H00057380-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRS2 Recombinant Protein (H00057380-P01) (0)

There are no reviews for MRS2 Recombinant Protein (H00057380-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRS2 Recombinant Protein (H00057380-P01). (Showing 1 - 1 of 1 FAQ).

  1. I would like to know, please, if you sell an Mrs2 (Magnesium Transporter) antibody to detect yeast Mrs2. i have seen you have a a couple of them for detection of human Mrs2. As the sequence identity between both species (yeast and human) is low, I am not sure if these antibodies would cross react.
    • Currently we have two antibodies to MRS2. Unfortunately, neither has been tested for cross reaction with the yeast protein. I was also not able to find the yeast sequence to run alignments against our products. If you have this and would like me to run an alignment against our two products, I would be happy to do so. We typically like to see 80+% homology between sequences for ideal cross reaction, but we have seen much lower percentages yield positive results. Since this species would not be covered under our 100% guarantee, we can offer you our Innovators Reward Program if you decide to try one of our products. In exchange for a review of your experiment using one of our products, we would issue you a credit for the purchase price of the antibody for use in a future purchase.

Additional MRS2 Products

Array H00057380-P01

Blogs on MRS2

There are no specific blogs for MRS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRS2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRS2