MRPL21 Antibody

Images

 
Western Blot: MRPL21 Antibody [NBP1-74139] - Mouse Liver Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Summary
Product Discontinued
View other related MRPL21 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74139
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MRPL21 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Mrpl21. Immunizing peptide sequence LPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLIL.
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Mrpl21 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRPL21 Antibody

  • L21mt
  • MGC62013
  • mitochondrial ribosomal protein L21
  • MRP-L21,39S ribosomal protein L21, mitochondrial

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS984
Species: Hu, GP, Mk, Pm
Applications: IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45836
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6544
Species: Hu
Applications: IHC
NBP2-49119
Species: Hu
Applications: WB, IHC
NLS6168
Species: Hu, Mk, Pm
Applications: ICC/IF (-), IP (-), WB (-), IHC-P, Flow (-)
NBP1-89362
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2846
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92455
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00009814-P01
Species: Hu

Publications for MRPL21 Antibody (NBP1-74139) (0)

There are no publications for MRPL21 Antibody (NBP1-74139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL21 Antibody (NBP1-74139) (0)

There are no reviews for MRPL21 Antibody (NBP1-74139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL21 Antibody (NBP1-74139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL21 Products

Bioinformatics Tool for MRPL21 Antibody (NBP1-74139)

Discover related pathways, diseases and genes to MRPL21 Antibody (NBP1-74139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL21 Antibody (NBP1-74139)

Discover more about diseases related to MRPL21 Antibody (NBP1-74139).
 

Pathways for MRPL21 Antibody (NBP1-74139)

View related products by pathway.

Blogs on MRPL21

There are no specific blogs for MRPL21, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL21
Entrez
Uniprot