MRG15 Antibody


Western Blot: MRG15 Antibody [NBP1-74218] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related MRG15 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MRG15 Antibody Summary

Synthetic peptides corresponding to the middle region of Morf4l1. Immunizing peptide sequence PEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Morf4l1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRG15 Antibody

  • Eaf3
  • Esa1p-associated factor 3 homolog
  • HsT17725
  • MEAF3
  • MGC10631
  • MORF-related gene on chromosome 15
  • MORFRG15
  • mortality factor 4 like 1
  • mortality factor 4-like protein 1
  • MRG15MORF-related gene 15 protein
  • Protein MSL3-1
  • S863-6
  • Transcription factor-like protein MRG15


Morf4l1 is a component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ch
Applications: WB, ChIP, IP
Species: Hu
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
Species: Hu
Species: Hu
Species: Hu
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu

Publications for MRG15 Antibody (NBP1-74218) (0)

There are no publications for MRG15 Antibody (NBP1-74218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRG15 Antibody (NBP1-74218) (0)

There are no reviews for MRG15 Antibody (NBP1-74218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRG15 Antibody (NBP1-74218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRG15 Products

Bioinformatics Tool for MRG15 Antibody (NBP1-74218)

Discover related pathways, diseases and genes to MRG15 Antibody (NBP1-74218). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRG15 Antibody (NBP1-74218)

Discover more about diseases related to MRG15 Antibody (NBP1-74218).

Pathways for MRG15 Antibody (NBP1-74218)

View related products by pathway.

PTMs for MRG15 Antibody (NBP1-74218)

Learn more about PTMs related to MRG15 Antibody (NBP1-74218).

Blogs on MRG15

There are no specific blogs for MRG15, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRG15 Antibody and receive a gift card or discount.


Gene Symbol MORF4L1