Recombinant Human MPRA Protein

Images

 
There are currently no images for MPRA Recombinant Protein (H00164091-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Recombinant Human MPRA Protein Summary

Description
MPRA (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PAQR7

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MPRA Protein

  • membrane progestin receptor alpha
  • mPR alpha
  • MPRA2310021M12Rik
  • MRPA
  • mSR
  • Progestin and adipoQ receptor family member 7
  • progestin and adipoQ receptor family member VIIPGLP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71693
Species: Hu
Applications: WB, ICC/IF
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr
NBP1-86594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30869
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP2-56507
Species: Hu
Applications: ICC/IF
H00164091-G01
Species: Hu

Publications for MPRA Recombinant Protein (H00164091-G01) (0)

There are no publications for MPRA Recombinant Protein (H00164091-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPRA Recombinant Protein (H00164091-G01) (0)

There are no reviews for MPRA Recombinant Protein (H00164091-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MPRA Recombinant Protein (H00164091-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPRA Products

Bioinformatics Tool for MPRA Recombinant Protein (H00164091-G01)

Discover related pathways, diseases and genes to MPRA Recombinant Protein (H00164091-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPRA Recombinant Protein (H00164091-G01)

Discover more about diseases related to MPRA Recombinant Protein (H00164091-G01).
 

Pathways for MPRA Recombinant Protein (H00164091-G01)

View related products by pathway.

PTMs for MPRA Recombinant Protein (H00164091-G01)

Learn more about PTMs related to MPRA Recombinant Protein (H00164091-G01).

Blogs on MPRA

There are no specific blogs for MPRA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SR-BI Antibody
NB400-104
SR-BI Antibody
NB400-104
SR-BI Antibody
NB400-104
MPRA Antibody
NBP2-13731
MPRA Antibody
NBP2-13731
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MPRA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAQR7