MPPED2 Antibody

Images

 
Immunohistochemistry: MPPED2 Antibody [NBP1-89393] - Staining of human duodenum shows strong granular cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related MPPED2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89393
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MPPED2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPPED2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPPED2 Antibody

  • 239FBchromosome 11 open reading frame 8
  • C11orf8dJ1024C24.1
  • D11S302E
  • dJ873F21.1
  • EC 3.1
  • FAM1B
  • Fetal brain protein 239
  • metallophosphoesterase domain containing 2
  • Metallophosphoesterase domain-containing protein 2
  • metallophosphoesterase MPPED2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NBP2-57012
Species: Hu
Applications: ICC/IF
NBP1-86440
Species: Hu
Applications: IHC, IHC-P
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NB100-87011
Species: Hu
Applications: WB, IP
NBP1-89393
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MPPED2 Antibody (NBP1-89393) (0)

There are no publications for MPPED2 Antibody (NBP1-89393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPPED2 Antibody (NBP1-89393) (0)

There are no reviews for MPPED2 Antibody (NBP1-89393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MPPED2 Antibody (NBP1-89393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPPED2 Products

Bioinformatics Tool for MPPED2 Antibody (NBP1-89393)

Discover related pathways, diseases and genes to MPPED2 Antibody (NBP1-89393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPPED2 Antibody (NBP1-89393)

Discover more about diseases related to MPPED2 Antibody (NBP1-89393).
 

Pathways for MPPED2 Antibody (NBP1-89393)

View related products by pathway.

Research Areas for MPPED2 Antibody (NBP1-89393)

Find related products by research area.

Blogs on MPPED2

There are no specific blogs for MPPED2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPPED2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPPED2