MPP3 Antibody

Images

 
Western Blot: MPP3 Antibody [NBP1-54859] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related MPP3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54859
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MPP3 Antibody Summary

Immunogen
Synthetic peptides corresponding to MPP3(membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3)) The peptide sequence was selected from the N terminal of MPP3. Peptide sequence RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV.
Clonality
Polyclonal
Host
Rabbit
Gene
MPP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MPP3 and was validated on Western blot.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MPP3 Antibody

  • Discs large homolog 3
  • discs, large homolog 3
  • DLG3MAGUK p55 subfamily member 3
  • membrane protein palmitoylated 3
  • membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3)
  • Protein MPP3

Background

This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-88088
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00003996-M01
Species: Hu
Applications: WB, ELISA
NBP1-84671
Species: Hu
Applications: WB, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87365
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP1-54859
Species: Hu
Applications: WB

Publications for MPP3 Antibody (NBP1-54859) (0)

There are no publications for MPP3 Antibody (NBP1-54859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPP3 Antibody (NBP1-54859) (0)

There are no reviews for MPP3 Antibody (NBP1-54859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPP3 Antibody (NBP1-54859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MPP3 Antibody (NBP1-54859)

Discover related pathways, diseases and genes to MPP3 Antibody (NBP1-54859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPP3 Antibody (NBP1-54859)

Discover more about diseases related to MPP3 Antibody (NBP1-54859).
 

Pathways for MPP3 Antibody (NBP1-54859)

View related products by pathway.

PTMs for MPP3 Antibody (NBP1-54859)

Learn more about PTMs related to MPP3 Antibody (NBP1-54859).

Blogs on MPP3

There are no specific blogs for MPP3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPP3
Uniprot