MPHOSPH6 Antibody

Images

 
Western Blot: MPHOSPH6 Antibody [NBP1-87365] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: MPHOSPH6 Antibody [NBP1-87365] - Staining in human testis and colon tissues using anti-MPP6 antibody. Corresponding MPP6 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry: MPHOSPH6 Antibody [NBP1-87365] - Analysis in human testis and colon tissues using Anti-MPP6 antibody. Corresponding MPP6 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: MPHOSPH6 Antibody [NBP1-87365] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: MPHOSPH6 Antibody [NBP1-87365] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MPHOSPH6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL
Specificity
Specificity of human MPHOSPH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPHOSPH6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MPHOSPH6 Protein (NBP1-87365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPHOSPH6 Antibody

  • M-phase phosphoprotein 6
  • MPP-6
  • MPP6MPP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-51684
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MPHOSPH6 Antibody (NBP1-87365) (0)

There are no publications for MPHOSPH6 Antibody (NBP1-87365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPHOSPH6 Antibody (NBP1-87365) (0)

There are no reviews for MPHOSPH6 Antibody (NBP1-87365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPHOSPH6 Antibody (NBP1-87365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPHOSPH6 Products

Bioinformatics Tool for MPHOSPH6 Antibody (NBP1-87365)

Discover related pathways, diseases and genes to MPHOSPH6 Antibody (NBP1-87365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MPHOSPH6 Antibody (NBP1-87365)

Find related products by research area.

Blogs on MPHOSPH6

There are no specific blogs for MPHOSPH6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPHOSPH6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPHOSPH6