MP1/MAP2K1IP1 Antibody (2A4)

Images

 
Western Blot: MP1/MAP2K1IP1 Antibody (2A4) [H00008649-M03] - Analysis of MAPKSP1 expression in transfected 293T cell line by MAPKSP1 monoclonal antibody (M03), clone 2A4. Lane 1: MAPKSP1 transfected lysatE (13.623 KDa). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MP1/MAP2K1IP1 Antibody (2A4) Summary

Immunogen
MAPKSP1 (NP_068805, 1 a.a. - 87 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP
Specificity
MAP2K1IP1 - mitogen-activated protein kinase kinase 1 interacting protein 1 (2A4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LAMTOR3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MP1/MAP2K1IP1 Antibody (2A4)

  • LAMTOR3
  • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
  • MAP2K1IP1
  • Mapbp
  • MAPK scaffold protein 1
  • MAPKSP1
  • MEK binding partner 1
  • MEK partner 1
  • MEK-binding partner 1
  • mitogen-activated protein kinase kinase 1 interacting protein 1
  • Mitogen-activated protein kinase kinase 1-interacting protein 1
  • Mitogen-activated protein kinase scaffold protein 1
  • MP1
  • PRO0633
  • Ragulator3

Background

The protein encoded by this gene was identified as an interacting protein that binds specifically to MAP kinase kinase MAP2K1/MEK1 and to MAP kinase MAPK2/ERK1. This protein enhances the activation of MAPK2, and thus is thought to function as an adaptor to enhance the efficiency of the MAP kinase cascade. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03) (0)

There are no publications for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03) (0)

There are no reviews for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MP1/MAP2K1IP1 Products

Bioinformatics Tool for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03)

Discover related pathways, diseases and genes to MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03)

Discover more about diseases related to MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03).
 

Pathways for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03)

View related products by pathway.

PTMs for MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03)

Learn more about PTMs related to MAP2K1IP1/MAPKSP1 Antibody (H00008649-M03).

Blogs on MP1/MAP2K1IP1

There are no specific blogs for MP1/MAP2K1IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MP1/MAP2K1IP1 Antibody (2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMTOR3
Entrez
Uniprot