MOX1 Partial Protein

Images

 
SDS-Page: MOX1 Partial Protein [H00004222-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

MOX1 Partial Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 165-252 of Human MOX1

Source: Wheat Germ

Amino Acid Sequence: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Protein
Gene
MEOX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOX1 Partial Protein

  • homeobox protein MOX-1
  • mesenchyme homeobox 1MOX1mesenchyme homeo box 1

Background

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NBP2-04309
Species: Hu
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, Flow, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC

Publications for MOX1 Partial Recombinant Protein (H00004222-Q01) (0)

There are no publications for MOX1 Partial Recombinant Protein (H00004222-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOX1 Partial Recombinant Protein (H00004222-Q01) (0)

There are no reviews for MOX1 Partial Recombinant Protein (H00004222-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOX1 Partial Recombinant Protein (H00004222-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOX1 Products

Bioinformatics Tool for MOX1 Partial Recombinant Protein (H00004222-Q01)

Discover related pathways, diseases and genes to MOX1 Partial Recombinant Protein (H00004222-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOX1 Partial Recombinant Protein (H00004222-Q01)

Discover more about diseases related to MOX1 Partial Recombinant Protein (H00004222-Q01).
 

Pathways for MOX1 Partial Recombinant Protein (H00004222-Q01)

View related products by pathway.

Blogs on MOX1

There are no specific blogs for MOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MOX1 Antibody
NBP1-92134

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOX1 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MEOX1