MORC1 Antibody

Images

 
Immunohistochemistry-Paraffin: MORC1 Antibody [NBP1-84351] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MORC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSSFELSASRRGQKRNIEETDSDVEYISETKIMKKSMEEKMNSQQQRIPVALPENVKLAERSQRSQIANITTVWRAQPTEGCLKNAQAASWEMKRKQ
Specificity
Specificity of human MORC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MORC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MORC1 Antibody

  • CT33microrchidia homolog (mouse)
  • microrchidia (mouse) homolog
  • MORC family CW-type zinc finger 1
  • MORC family CW-type zinc finger protein 1
  • MORC
  • mouse, homolog of
  • ZCW6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22151
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
7668-GH/CF
Species: Hu
NBP1-89295
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NB100-55400
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-41309
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84351
Species: Hu
Applications: IHC, IHC-P

Publications for MORC1 Antibody (NBP1-84351) (0)

There are no publications for MORC1 Antibody (NBP1-84351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MORC1 Antibody (NBP1-84351) (0)

There are no reviews for MORC1 Antibody (NBP1-84351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MORC1 Antibody (NBP1-84351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MORC1 Products

Bioinformatics Tool for MORC1 Antibody (NBP1-84351)

Discover related pathways, diseases and genes to MORC1 Antibody (NBP1-84351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MORC1 Antibody (NBP1-84351)

Discover more about diseases related to MORC1 Antibody (NBP1-84351).
 

Pathways for MORC1 Antibody (NBP1-84351)

View related products by pathway.

PTMs for MORC1 Antibody (NBP1-84351)

Learn more about PTMs related to MORC1 Antibody (NBP1-84351).

Blogs on MORC1

There are no specific blogs for MORC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MORC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MORC1