MOBKL2B Antibody

Images

 
Western Blot: MOBKL2B Antibody [NBP2-84167] - Host: Rabbit. Target Name: MOBKL2B. Sample Tissue: Human A549 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOBKL2B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MOBKL2B. Peptide sequence: NLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MOB3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOBKL2B Antibody

  • Em:AL163192.1
  • FLJ13204
  • FLJ23916
  • Mob1 homolog 2b
  • MOB1, Mps One Binder kinase activator-like 2B (yeast)
  • MOB3BMGC32960
  • monopolar spindle 1 binding, MOB1, domain containing
  • mps one binder kinase activator-like 2B
  • Protein Mob3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
H00089884-M15
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-68688
Species: Hu
Applications: IHC, IHC-P
AF5206
Species: Mu
Applications: WB, Simple Western
NBP2-75459
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-93504
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45565
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1436
Species: Mu
Applications: WB
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, IHC, IHC-P, IF
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-84167
Species: Hu
Applications: WB

Publications for MOBKL2B Antibody (NBP2-84167) (0)

There are no publications for MOBKL2B Antibody (NBP2-84167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOBKL2B Antibody (NBP2-84167) (0)

There are no reviews for MOBKL2B Antibody (NBP2-84167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOBKL2B Antibody (NBP2-84167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MOBKL2B Products

Bioinformatics Tool for MOBKL2B Antibody (NBP2-84167)

Discover related pathways, diseases and genes to MOBKL2B Antibody (NBP2-84167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MOBKL2B

There are no specific blogs for MOBKL2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOBKL2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOB3B