MMP21 Antibody

Images

 
Western Blot: MMP21 Antibody [NBP1-85980] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MMP21 Antibody [NBP1-85980] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: MMP21 Antibody [NBP1-85980] - Staining of human kidney shows strong cytoplasmic and membrane positivity in renal tubules.

Product Details

Summary
Product Discontinued
View other related MMP21 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-85980
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MMP21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VAVHEIGHVLGLPHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFRNSWYWLYENRNNRTRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMP21 Antibody

  • EC 3.4.24
  • EC 3.4.24.-
  • matrix metallopeptidase 21
  • matrix metalloproteinase 21
  • matrix metalloproteinase-21
  • MMP-21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056547-M01
Species: Hu
Applications: WB, ELISA
NBP2-17314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AB924
Species: Hu, Mu
Applications: WB, IHC, IP
AF6790
Species: Hu
Applications: WB, IHC
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85980
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MMP21 Antibody (NBP1-85980) (0)

There are no publications for MMP21 Antibody (NBP1-85980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP21 Antibody (NBP1-85980) (0)

There are no reviews for MMP21 Antibody (NBP1-85980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMP21 Antibody (NBP1-85980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP21 Products

Bioinformatics Tool for MMP21 Antibody (NBP1-85980)

Discover related pathways, diseases and genes to MMP21 Antibody (NBP1-85980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP21 Antibody (NBP1-85980)

Discover more about diseases related to MMP21 Antibody (NBP1-85980).
 

Pathways for MMP21 Antibody (NBP1-85980)

View related products by pathway.

Research Areas for MMP21 Antibody (NBP1-85980)

Find related products by research area.

Blogs on MMP21

There are no specific blogs for MMP21, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP21