MMP-9 Antibody (2H4) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related MMP-9 Primary Antibodies

Order Details


    • Catalog Number
      H00004318-M03IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MMP-9 Antibody (2H4) [DyLight 755] Summary

Immunogen
MMP9 (AAH06093.1, 1 a.a. - 707 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Specificity
MMP9 - matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (2H4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MMP9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP-9 Antibody (2H4) [DyLight 755]

  • 92 kDa gelatinase
  • 92 kDa type IV collagenase
  • CLG4B
  • EC 3.4.24
  • EC 3.4.24.35
  • Gelatinase B
  • GELB
  • macrophage gelatinase
  • MANDP2
  • matrix metallopeptidase 9
  • matrix metalloproteinase 9
  • matrix metalloproteinase-9
  • MMP9
  • MMP-9
  • type V collagenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for MMP-9 Antibody (H00004318-M03IR) (0)

There are no publications for MMP-9 Antibody (H00004318-M03IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-9 Antibody (H00004318-M03IR) (0)

There are no reviews for MMP-9 Antibody (H00004318-M03IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMP-9 Antibody (H00004318-M03IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-9 Products

Bioinformatics Tool for MMP-9 Antibody (H00004318-M03IR)

Discover related pathways, diseases and genes to MMP-9 Antibody (H00004318-M03IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-9 Antibody (H00004318-M03IR)

Discover more about diseases related to MMP-9 Antibody (H00004318-M03IR).
 

Pathways for MMP-9 Antibody (H00004318-M03IR)

View related products by pathway.

PTMs for MMP-9 Antibody (H00004318-M03IR)

Learn more about PTMs related to MMP-9 Antibody (H00004318-M03IR).
 

Research Areas for MMP-9 Antibody (H00004318-M03IR)

Find related products by research area.

Blogs on MMP-9.

Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component
Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-9 Antibody (2H4) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP9
Entrez