MMP-13 Antibody (3B11)

Images

 
Western Blot: MMP-13 Antibody (3B11) [H00004322-M07] - Analysis of MMP13 expression in transfected 293T cell line by MMP13 monoclonal antibody (M07), clone 3B11. Lane 1: MMP13 transfected lysatE (53.8 KDa). Lane 2: ...read more
Western Blot: MMP-13 Antibody (3B11) [H00004322-M07] - Analysis of MMP13 transfected lysate using anti-MMP13 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP13 rabbit polyclonal antibody.
Western Blot: MMP-13 Antibody (3B11) [H00004322-M07] - Analysis of MMP13 over-expressed 293 cell line, cotransfected with MMP13 Validated Chimera RNAi (Cat # H00004322-R01V ) (Lane 2) or non-transfected control (Lane ...read more
ELISA: MMP-13 Antibody (3B11) [H00004322-M07] - Detection limit for recombinant GST tagged MMP13 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, RNAi
Clone
3B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MMP-13 Antibody (3B11) Summary

Immunogen
MMP13 (NP_002418 362 a.a. - 471 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Specificity
MMP13 - matrix metallopeptidase 13 (collagenase 3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MMP13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP-13 Antibody (3B11)

  • CLG 3
  • CLG3EC 3.4.24
  • collagenase 3
  • EC 3.4.24.-
  • EC 3.4.24.22
  • EC 3.4.24.24
  • EC 3.4.24.35
  • EC 3.4.24.65
  • EC 3.4.24.7
  • MANDP1
  • matrix metallopeptidase 13 (collagenase 3)
  • matrix metalloproteinase 13 (collagenase 3)
  • Matrix metalloproteinase-13
  • MMP13
  • MMP-13

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for MMP-13 Antibody (H00004322-M07) (0)

There are no publications for MMP-13 Antibody (H00004322-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-13 Antibody (H00004322-M07) (0)

There are no reviews for MMP-13 Antibody (H00004322-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP-13 Antibody (H00004322-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-13 Products

Bioinformatics Tool for MMP-13 Antibody (H00004322-M07)

Discover related pathways, diseases and genes to MMP-13 Antibody (H00004322-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-13 Antibody (H00004322-M07)

Discover more about diseases related to MMP-13 Antibody (H00004322-M07).
 

Pathways for MMP-13 Antibody (H00004322-M07)

View related products by pathway.

PTMs for MMP-13 Antibody (H00004322-M07)

Learn more about PTMs related to MMP-13 Antibody (H00004322-M07).
 

Research Areas for MMP-13 Antibody (H00004322-M07)

Find related products by research area.

Blogs on MMP-13

There are no specific blogs for MMP-13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-13 Antibody (3B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP13
Entrez
OMIM
Uniprot