MLLT6 Antibody (1B2) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related MLLT6 Primary Antibodies

Order Details


    • Catalog Number
      H00004302-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MLLT6 Antibody (1B2) [PerCP] Summary

Immunogen
MLLT6 (AAH07237, 1 a.a. - 462 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG
Specificity
MLLT6 (1B2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MLLT6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MLLT6 Antibody (1B2) [PerCP]

  • AF17Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6
  • ALL1-fused gene from chromosome 17 protein
  • FLJ23480
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 6
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 6
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 6
  • protein AF-17
  • trithorax homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NBP2-15620
Species: Hu
Applications: WB
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-88351
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-49672
Species: Hu
Applications: IHC
H00004302-M02PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MLLT6 Antibody (H00004302-M02PCP) (0)

There are no publications for MLLT6 Antibody (H00004302-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLLT6 Antibody (H00004302-M02PCP) (0)

There are no reviews for MLLT6 Antibody (H00004302-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MLLT6 Antibody (H00004302-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLLT6 Products

Bioinformatics Tool for MLLT6 Antibody (H00004302-M02PCP)

Discover related pathways, diseases and genes to MLLT6 Antibody (H00004302-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLLT6 Antibody (H00004302-M02PCP)

Discover more about diseases related to MLLT6 Antibody (H00004302-M02PCP).
 

Pathways for MLLT6 Antibody (H00004302-M02PCP)

View related products by pathway.

PTMs for MLLT6 Antibody (H00004302-M02PCP)

Learn more about PTMs related to MLLT6 Antibody (H00004302-M02PCP).

Blogs on MLLT6

There are no specific blogs for MLLT6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLLT6 Antibody (1B2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT6