MLLT1 Antibody (3H2) [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related MLLT1 Primary Antibodies

Order Details


    • Catalog Number
      H00004298-M01AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MLLT1 Antibody (3H2) [Alexa Fluor® 700] Summary

Immunogen
MLLT1 (NP_005925 472 a.a. - 558 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA
Specificity
MLLT1 - myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MLLT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25481096). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for MLLT1 Antibody (3H2) [Alexa Fluor® 700]

  • ENLENL/MLL fusion
  • LTG19MLLT1/MLL fusion
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 1
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 1
  • protein ENL
  • YEATS domain-containing protein 1
  • YEATS1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
AF7829
Species: Hu
Applications: WB, IHC, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-16610
Species: Hu
Applications: WB
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00004298-M01AF700
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for MLLT1 Antibody (H00004298-M01AF700) (0)

There are no publications for MLLT1 Antibody (H00004298-M01AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLLT1 Antibody (H00004298-M01AF700) (0)

There are no reviews for MLLT1 Antibody (H00004298-M01AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MLLT1 Antibody (H00004298-M01AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLLT1 Products

Bioinformatics Tool for MLLT1 Antibody (H00004298-M01AF700)

Discover related pathways, diseases and genes to MLLT1 Antibody (H00004298-M01AF700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLLT1 Antibody (H00004298-M01AF700)

Discover more about diseases related to MLLT1 Antibody (H00004298-M01AF700).
 

Pathways for MLLT1 Antibody (H00004298-M01AF700)

View related products by pathway.

PTMs for MLLT1 Antibody (H00004298-M01AF700)

Learn more about PTMs related to MLLT1 Antibody (H00004298-M01AF700).

Blogs on MLLT1

There are no specific blogs for MLLT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLLT1 Antibody (3H2) [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT1