MKRN3 Antibody (2E10.) [DyLight 488]



Product Details

Product Discontinued
View other related MKRN3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKRN3 Antibody (2E10.) [DyLight 488] Summary

MKRN3 (NP_005655 437 a.a. - 507 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
MKRN3 (2E10)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MKRN3 Antibody (2E10.) [DyLight 488]

  • EC 6.3.2.-
  • makorin ring finger protein 3
  • MGC88288
  • RNF63D15S9
  • ZFP127RING finger protein 63
  • Zinc finger protein 127
  • ZNF127probable E3 ubiquitin-protein ligase makorin-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
Species: Hu

Publications for MKRN3 Antibody (H00007681-M01G) (0)

There are no publications for MKRN3 Antibody (H00007681-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN3 Antibody (H00007681-M01G) (0)

There are no reviews for MKRN3 Antibody (H00007681-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MKRN3 Antibody (H00007681-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MKRN3 Products

Bioinformatics Tool for MKRN3 Antibody (H00007681-M01G)

Discover related pathways, diseases and genes to MKRN3 Antibody (H00007681-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKRN3 Antibody (H00007681-M01G)

Discover more about diseases related to MKRN3 Antibody (H00007681-M01G).

Pathways for MKRN3 Antibody (H00007681-M01G)

View related products by pathway.

PTMs for MKRN3 Antibody (H00007681-M01G)

Learn more about PTMs related to MKRN3 Antibody (H00007681-M01G).

Research Areas for MKRN3 Antibody (H00007681-M01G)

Find related products by research area.

Blogs on MKRN3

There are no specific blogs for MKRN3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MKRN3 Antibody (2E10.) [DyLight 488] and receive a gift card or discount.


Gene Symbol MKRN3