MKRN3 Antibody (2E10.) [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related MKRN3 Primary Antibodies

Order Details


    • Catalog Number
      H00007681-M01AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKRN3 Antibody (2E10.) [Alexa Fluor® 405] Summary

Immunogen
MKRN3 (NP_005655 437 a.a. - 507 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
Specificity
MKRN3 (2E10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MKRN3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for MKRN3 Antibody (2E10.) [Alexa Fluor® 405]

  • EC 6.3.2.-
  • makorin ring finger protein 3
  • MGC88288
  • RNF63D15S9
  • ZFP127RING finger protein 63
  • Zinc finger protein 127
  • ZNF127probable E3 ubiquitin-protein ligase makorin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
NBP1-60052
Species: Hu
Applications: WB
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00006047-A01
Species: Hu
Applications: WB, ELISA
NBP2-49382
Species: Hu
Applications: IHC
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
H00027130-P02
Species: Hu

Publications for MKRN3 Antibody (H00007681-M01AF405) (0)

There are no publications for MKRN3 Antibody (H00007681-M01AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN3 Antibody (H00007681-M01AF405) (0)

There are no reviews for MKRN3 Antibody (H00007681-M01AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MKRN3 Antibody (H00007681-M01AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKRN3 Products

MKRN3 H00007681-M01AF405

Bioinformatics Tool for MKRN3 Antibody (H00007681-M01AF405)

Discover related pathways, diseases and genes to MKRN3 Antibody (H00007681-M01AF405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKRN3 Antibody (H00007681-M01AF405)

Discover more about diseases related to MKRN3 Antibody (H00007681-M01AF405).
 

Pathways for MKRN3 Antibody (H00007681-M01AF405)

View related products by pathway.

PTMs for MKRN3 Antibody (H00007681-M01AF405)

Learn more about PTMs related to MKRN3 Antibody (H00007681-M01AF405).
 

Research Areas for MKRN3 Antibody (H00007681-M01AF405)

Find related products by research area.

Blogs on MKRN3

There are no specific blogs for MKRN3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKRN3 Antibody (2E10.) [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol MKRN3