MKRN2 Antibody

Images

 
Western Blot: MKRN2 Antibody [NBP1-53022] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related MKRN2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53022
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKRN2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MKRN2(makorin, ring finger protein, 2) The peptide sequence was selected from the N terminal of MKRN2. Peptide sequence STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC.
Clonality
Polyclonal
Host
Rabbit
Gene
MKRN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MKRN2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MKRN2 Antibody

  • EC 6.3.2.-
  • HSPC070
  • makorin ring finger protein 2
  • probable E3 ubiquitin-protein ligase makorin-2
  • RNF62RING finger protein 62

Background

Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2778 BC015715.1 24-2801

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45816
Species: Hu
Applications: WB, Flow, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-321
Species: Hu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
AF5770
Species: Hu
Applications: WB, IHC
NBP1-81013
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for MKRN2 Antibody (NBP1-53022) (0)

There are no publications for MKRN2 Antibody (NBP1-53022).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN2 Antibody (NBP1-53022) (0)

There are no reviews for MKRN2 Antibody (NBP1-53022). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKRN2 Antibody (NBP1-53022) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKRN2 Products

Bioinformatics Tool for MKRN2 Antibody (NBP1-53022)

Discover related pathways, diseases and genes to MKRN2 Antibody (NBP1-53022). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKRN2 Antibody (NBP1-53022)

Discover more about diseases related to MKRN2 Antibody (NBP1-53022).
 

Pathways for MKRN2 Antibody (NBP1-53022)

View related products by pathway.

Research Areas for MKRN2 Antibody (NBP1-53022)

Find related products by research area.

Blogs on MKRN2

There are no specific blogs for MKRN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKRN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKRN2
Uniprot