MKRN1 Antibody

Images

 
Western Blot: MKRN1 Antibody [NBP1-55280] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Product Discontinued
View other related MKRN1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55280
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKRN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MKRN1(makorin, ring finger protein, 1) The peptide sequence was selected from the C terminal of MKRN1. Peptide sequence RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW.
Clonality
Polyclonal
Host
Rabbit
Gene
MKRN1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MKRN1 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
MKRN1 Lysate (NBP2-65768)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MKRN1 Antibody

  • E3 ubiquitin-protein ligase makorin-1
  • EC 6.3.2.-
  • FLJ21334
  • makorin ring finger protein 1
  • RNF61RING finger protein 61

Background

The Makorin ring finger protein-1 (MKRN1) is a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83179
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47567
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
MAB7047
Species: Hu
Applications: WB, ICC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33686
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006976-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-55280
Species: Hu
Applications: WB

Publications for MKRN1 Antibody (NBP1-55280) (0)

There are no publications for MKRN1 Antibody (NBP1-55280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN1 Antibody (NBP1-55280) (0)

There are no reviews for MKRN1 Antibody (NBP1-55280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKRN1 Antibody (NBP1-55280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MKRN1 Antibody (NBP1-55280)

Discover related pathways, diseases and genes to MKRN1 Antibody (NBP1-55280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKRN1 Antibody (NBP1-55280)

Discover more about diseases related to MKRN1 Antibody (NBP1-55280).
 

Pathways for MKRN1 Antibody (NBP1-55280)

View related products by pathway.

PTMs for MKRN1 Antibody (NBP1-55280)

Learn more about PTMs related to MKRN1 Antibody (NBP1-55280).
 

Research Areas for MKRN1 Antibody (NBP1-55280)

Find related products by research area.

Blogs on MKRN1

There are no specific blogs for MKRN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKRN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKRN1