MKP-3/DUSP6 Antibody (3G2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MKP-3/DUSP6 Primary Antibodies

Order Details


    • Catalog Number
      H00001848-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKP-3/DUSP6 Antibody (3G2) [PE] Summary

Immunogen
DUSP6 (AAH03143, 1 a.a. ~ 382 a.a) full length recombinant protein with GST tag.MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQ ELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRD RFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEG CRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLG GLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPN
Localization
Cytoplasmic
Specificity
DUSP6 - dual specificity phosphatase 6
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DUSP6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MKP-3/DUSP6 Antibody (3G2) [PE]

  • dual specificity phosphatase 6
  • Dual specificity protein phosphatase PYST1
  • DUSP6
  • EC 3.1.3.16
  • EC 3.1.3.48
  • MAP kinase phosphatase 3
  • Mitogen-activated protein kinase phosphatase 3
  • MKP3
  • MKP-3
  • MKP3serine/threonine specific protein phosphatase
  • PYST1
  • PYST1dual specificity protein phosphatase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
423-F8/CF
Species: Hu, Mu
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MKP-3/DUSP6 Antibody (H00001848-M01PE) (0)

There are no publications for MKP-3/DUSP6 Antibody (H00001848-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKP-3/DUSP6 Antibody (H00001848-M01PE) (0)

There are no reviews for MKP-3/DUSP6 Antibody (H00001848-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKP-3/DUSP6 Antibody (H00001848-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKP-3/DUSP6 Products

Bioinformatics Tool for MKP-3/DUSP6 Antibody (H00001848-M01PE)

Discover related pathways, diseases and genes to MKP-3/DUSP6 Antibody (H00001848-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKP-3/DUSP6 Antibody (H00001848-M01PE)

Discover more about diseases related to MKP-3/DUSP6 Antibody (H00001848-M01PE).
 

Pathways for MKP-3/DUSP6 Antibody (H00001848-M01PE)

View related products by pathway.

PTMs for MKP-3/DUSP6 Antibody (H00001848-M01PE)

Learn more about PTMs related to MKP-3/DUSP6 Antibody (H00001848-M01PE).
 

Research Areas for MKP-3/DUSP6 Antibody (H00001848-M01PE)

Find related products by research area.

Blogs on MKP-3/DUSP6

There are no specific blogs for MKP-3/DUSP6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKP-3/DUSP6 Antibody (3G2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP6
Entrez