MKL2 Antibody

Images

 
Western Blot: MKL2 Antibody [NBP1-83535] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MKL2 Antibody [NBP1-83535] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: MKL2 Antibody [NBP1-83535] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.
Western Blot: MKL2 Antibody [NBP1-83535] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Simple Western: MKL2 Antibody [NBP1-83535] - Simple Western lane view shows a specific band for MKL2 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: MKL2 Antibody [NBP1-83535] - Electropherogram image(s) of corresponding Simple Western lane view. MKL2 antibody was used at 1:25 dilution on RT-4 lysate(s).

Product Details

Summary
Product Discontinued
View other related MKL2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83535
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Publications
Read Publication using
NBP1-83535 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23692340).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MKL2 Antibody

  • DKFZp686J1745
  • FLJ31823
  • FLJ45623
  • KIAA1243
  • megakaryoblastic leukemia 2
  • MKL/myocardin-like 2
  • MKL/myocardin-like protein 2
  • MRTFB
  • MRTF-B
  • myocardin-related transcription factor B
  • NPD001

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92248
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-80716
Species: Hu
Applications: IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-55275
Species: Hu
Applications: ICC/IF

Publications for MKL2 Antibody (NBP1-83535)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MKL2 Antibody (NBP1-83535) (0)

There are no reviews for MKL2 Antibody (NBP1-83535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKL2 Antibody (NBP1-83535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKL2 Products

Bioinformatics Tool for MKL2 Antibody (NBP1-83535)

Discover related pathways, diseases and genes to MKL2 Antibody (NBP1-83535). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKL2 Antibody (NBP1-83535)

Discover more about diseases related to MKL2 Antibody (NBP1-83535).
 

Pathways for MKL2 Antibody (NBP1-83535)

View related products by pathway.

PTMs for MKL2 Antibody (NBP1-83535)

Learn more about PTMs related to MKL2 Antibody (NBP1-83535).

Blogs on MKL2

There are no specific blogs for MKL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKL2