Recombinant Human MKK6/MEK6 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related MKK6/MEK6 Peptides and Proteins

Order Details


    • Catalog Number
      H00005608-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human MKK6/MEK6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 231-334 of Human MAP2K6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAP2K6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MKK6/MEK6 Protein

  • MAP kinase kinase 6
  • MAP2K6
  • MAPK/ERK kinase 6
  • MAPKK6dual specificity mitogen-activated protein kinase kinase 6
  • MEK6
  • MEK6MAPKK 6
  • mitogen-activated protein kinase kinase 6
  • MKK6
  • MKK6MEK 6
  • PRKMK6
  • PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6)
  • SAPKK3
  • SAPKK3EC 2.7.12.2

Background

MAP2K6 - mitogen-activated protein kinase kinase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37542
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01) (0)

There are no publications for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01) (0)

There are no reviews for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MKK6/MEK6 Products

Bioinformatics Tool for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01)

Discover related pathways, diseases and genes to MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01)

Discover more about diseases related to MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01).
 

Pathways for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01)

View related products by pathway.

PTMs for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01)

Learn more about PTMs related to MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01).
 

Research Areas for MKK6/MEK6 Partial Recombinant Protein (H00005608-Q01)

Find related products by research area.

Blogs on MKK6/MEK6

There are no specific blogs for MKK6/MEK6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MKK6/MEK6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2K6
Entrez