MKK6/MEK6 Antibody (2F2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MKK6/MEK6 Primary Antibodies

Order Details


    • Catalog Number
      H00005608-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKK6/MEK6 Antibody (2F2) [PE] Summary

Immunogen
MAP2K6 (AAH12009 231 a.a. - 334 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Specificity
MAP2K6 (2F2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP2K6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MKK6/MEK6 Antibody (2F2) [PE]

  • MAP kinase kinase 6
  • MAP2K6
  • MAPK/ERK kinase 6
  • MAPKK6dual specificity mitogen-activated protein kinase kinase 6
  • MEK6
  • MEK6MAPKK 6
  • mitogen-activated protein kinase kinase 6
  • MKK6
  • MKK6MEK 6
  • PRKMK6
  • PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6)
  • SAPKK3
  • SAPKK3EC 2.7.12.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37542
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for MKK6/MEK6 Antibody (H00005608-M02PE) (0)

There are no publications for MKK6/MEK6 Antibody (H00005608-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKK6/MEK6 Antibody (H00005608-M02PE) (0)

There are no reviews for MKK6/MEK6 Antibody (H00005608-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKK6/MEK6 Antibody (H00005608-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKK6/MEK6 Products

Bioinformatics Tool for MKK6/MEK6 Antibody (H00005608-M02PE)

Discover related pathways, diseases and genes to MKK6/MEK6 Antibody (H00005608-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKK6/MEK6 Antibody (H00005608-M02PE)

Discover more about diseases related to MKK6/MEK6 Antibody (H00005608-M02PE).
 

Pathways for MKK6/MEK6 Antibody (H00005608-M02PE)

View related products by pathway.

PTMs for MKK6/MEK6 Antibody (H00005608-M02PE)

Learn more about PTMs related to MKK6/MEK6 Antibody (H00005608-M02PE).
 

Research Areas for MKK6/MEK6 Antibody (H00005608-M02PE)

Find related products by research area.

Blogs on MKK6/MEK6

There are no specific blogs for MKK6/MEK6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKK6/MEK6 Antibody (2F2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2K6
Entrez