Recombinant Human mitochondrial ribosomal protein L27 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human mitochondrial ribosomal protein L27 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-148 of Human MRPL27 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MRPL27

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human mitochondrial ribosomal protein L27 Protein

  • L27mt
  • MGC23716
  • mitochondrial ribosomal protein L27
  • mitochondrial

Background

MRPL27( AAH01066, 1 a.a. - 149 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37393
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-91663
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NBP1-83761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1585
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP, PLA
AF4779
Species: Hu
Applications: WB, IHC
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NBP2-13613
Species: Hu
Applications: WB, IHC, IHC-P

Publications for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01) (0)

There are no publications for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01) (0)

There are no reviews for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional mitochondrial ribosomal protein L27 Products

Bioinformatics Tool for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01)

Discover related pathways, diseases and genes to mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for mitochondrial ribosomal protein L27 Recombinant Protein (H00051264-P01)

View related products by pathway.

Blogs on mitochondrial ribosomal protein L27

There are no specific blogs for mitochondrial ribosomal protein L27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HDAC1 Antibody
NB100-56340
HDAC3 Antibody
NB100-1669

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human mitochondrial ribosomal protein L27 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL27