MICL/CLEC12A Antibody

Images

 
Immunohistochemistry-Paraffin: MICL/CLEC12A Antibody [NBP2-13843] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MICL/CLEC12A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQES KMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDN IINSSAWVIRNAPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC12A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MICL/CLEC12A Protein (NBP2-13843PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MICL/CLEC12A Antibody

  • CD371
  • CLEC12A
  • CLL1
  • CLL-1
  • C-type lectin domain family 12, member A
  • DCAL-2
  • MICL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1859
Species: Hu
Applications: Flow, Block, CyTOF-ready, ICC
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-22568
Species: Hu
Applications: IHC-P
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NBP2-13843
Species: Hu
Applications: IHC, IHC-P

Publications for MICL/CLEC12A Antibody (NBP2-13843) (0)

There are no publications for MICL/CLEC12A Antibody (NBP2-13843).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICL/CLEC12A Antibody (NBP2-13843) (0)

There are no reviews for MICL/CLEC12A Antibody (NBP2-13843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MICL/CLEC12A Antibody (NBP2-13843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MICL/CLEC12A Products

Bioinformatics Tool for MICL/CLEC12A Antibody (NBP2-13843)

Discover related pathways, diseases and genes to MICL/CLEC12A Antibody (NBP2-13843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MICL/CLEC12A Antibody (NBP2-13843)

Discover more about diseases related to MICL/CLEC12A Antibody (NBP2-13843).
 

Pathways for MICL/CLEC12A Antibody (NBP2-13843)

View related products by pathway.

PTMs for MICL/CLEC12A Antibody (NBP2-13843)

Learn more about PTMs related to MICL/CLEC12A Antibody (NBP2-13843).

Blogs on MICL/CLEC12A

There are no specific blogs for MICL/CLEC12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICL/CLEC12A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC12A
Entrez