MICAL2 Antibody

Images

 
Western Blot: MICAL2 Antibody [NBP2-83207] - Host: Rabbit. Target Name: MICAL2. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MICAL2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human MICAL2. Peptide sequence: KALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MICAL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MICAL2 Antibody

  • DKFZp686H03148
  • DKFZp686H2469
  • flavoprotein oxidoreductase MICAL2
  • KIAA0750MICAL2PV2
  • MICAL2PV1
  • microtubule associated monoxygenase, calponin and LIM domain containing 2
  • protein MICAL-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03135
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00057553-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-82073
Species: Hu
Applications: IHC, IHC-P
H00006812-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-05251
Species: Hu, Mu
Applications: WB
NBP2-66840
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBL1-16214
Species: Hu
Applications: WB
H00085377-B01P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-82868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3937
Species: Hu
Applications: IHC, Simple Western, WB
DTSP10
Species: Hu
Applications: ELISA
NBP2-45883
Species: Hu
Applications: IHC, WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87748
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MICAL2 Antibody (NBP2-83207) (0)

There are no publications for MICAL2 Antibody (NBP2-83207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICAL2 Antibody (NBP2-83207) (0)

There are no reviews for MICAL2 Antibody (NBP2-83207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MICAL2 Antibody (NBP2-83207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MICAL2 Products

Bioinformatics Tool for MICAL2 Antibody (NBP2-83207)

Discover related pathways, diseases and genes to MICAL2 Antibody (NBP2-83207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MICAL2 Antibody (NBP2-83207)

Discover more about diseases related to MICAL2 Antibody (NBP2-83207).
 

Pathways for MICAL2 Antibody (NBP2-83207)

View related products by pathway.

Blogs on MICAL2

There are no specific blogs for MICAL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICAL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MICAL2