Recombinant Human mGluR2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related mGluR2 Peptides and Proteins

Order Details


    • Catalog Number
      H00002912-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human mGluR2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-93 of Human GRM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
GRM2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human mGluR2 Protein

  • GLUR2
  • glutamate metabotropic receptor 2
  • glutamate receptor, metabotropic 2
  • GPRC1B
  • GPRC1Bmetabotropic glutamate receptor 2
  • GRM2
  • mGlu2
  • mGluR2
  • MGLUR2glutamate receptor homolog
  • mGluR7

Background

GRM2 - glutamate receptor, metabotropic 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
H00002912-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for mGluR2 Partial Recombinant Protein (H00002912-Q01) (0)

There are no publications for mGluR2 Partial Recombinant Protein (H00002912-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR2 Partial Recombinant Protein (H00002912-Q01) (0)

There are no reviews for mGluR2 Partial Recombinant Protein (H00002912-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mGluR2 Partial Recombinant Protein (H00002912-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional mGluR2 Products

Bioinformatics Tool for mGluR2 Partial Recombinant Protein (H00002912-Q01)

Discover related pathways, diseases and genes to mGluR2 Partial Recombinant Protein (H00002912-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR2 Partial Recombinant Protein (H00002912-Q01)

Discover more about diseases related to mGluR2 Partial Recombinant Protein (H00002912-Q01).
 

Pathways for mGluR2 Partial Recombinant Protein (H00002912-Q01)

View related products by pathway.

PTMs for mGluR2 Partial Recombinant Protein (H00002912-Q01)

Learn more about PTMs related to mGluR2 Partial Recombinant Protein (H00002912-Q01).
 

Research Areas for mGluR2 Partial Recombinant Protein (H00002912-Q01)

Find related products by research area.

Blogs on mGluR2

There are no specific blogs for mGluR2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human mGluR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM2
Entrez