MFRP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MFRP Antibody [NBP1-88315] - Staining of human cell line U-251 MG shows positivity in mitochondria.
Immunohistochemistry-Paraffin: MFRP Antibody [NBP1-88315] - Staining of human kidney shows strong membranous and cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFRP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LCTWHISVPAGHSIELQFHNFSLEAQDECKFDYVEVYETSSSGAFSLLGRFCGAEPPPHLVSSHHELAVLFRTDHGISSGGFSATYLAFNATENPCGPSELSCQAGGCKGVQWM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MFRP Protein (NBP1-88315PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MFRP Antibody

  • MCOP5
  • membrane frizzled-related protein
  • Membrane-type frizzled-related protein
  • MFRP
  • MGC32938
  • NNO2
  • rd6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3167
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
H00338917-T01
Species: Hu
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBL1-10820
Species: Hu
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
AF1120
Species: Mu
Applications: WB, IHC
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-81150
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MFRP Antibody (NBP1-88315) (0)

There are no publications for MFRP Antibody (NBP1-88315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFRP Antibody (NBP1-88315) (0)

There are no reviews for MFRP Antibody (NBP1-88315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MFRP Antibody (NBP1-88315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MFRP Products

Bioinformatics Tool for MFRP Antibody (NBP1-88315)

Discover related pathways, diseases and genes to MFRP Antibody (NBP1-88315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFRP Antibody (NBP1-88315)

Discover more about diseases related to MFRP Antibody (NBP1-88315).
 

Pathways for MFRP Antibody (NBP1-88315)

View related products by pathway.

PTMs for MFRP Antibody (NBP1-88315)

Learn more about PTMs related to MFRP Antibody (NBP1-88315).
 

Research Areas for MFRP Antibody (NBP1-88315)

Find related products by research area.

Blogs on MFRP

There are no specific blogs for MFRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFRP
Entrez