MEX3A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MEX3A Antibody [NBP2-57357] - Staining of human cell line SH-SY5Y shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEX3A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI
Specificity
Specificity of human MEX3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEX3A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MEX3A Recombinant Protein Antigen (NBP2-57357PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MEX3A Antibody

  • MEX3A mex-3 homolog A
  • MEX-3A
  • ring finger and KH domain containing 4
  • RING finger and KH domain-containing protein 4
  • RKHD4
  • RNA-binding protein MEX3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MEX3A Antibody (NBP2-57357) (0)

There are no publications for MEX3A Antibody (NBP2-57357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEX3A Antibody (NBP2-57357) (0)

There are no reviews for MEX3A Antibody (NBP2-57357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MEX3A Antibody (NBP2-57357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-57357

Bioinformatics Tool for MEX3A Antibody (NBP2-57357)

Discover related pathways, diseases and genes to MEX3A Antibody (NBP2-57357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEX3A Antibody (NBP2-57357)

Discover more about diseases related to MEX3A Antibody (NBP2-57357).
 

Pathways for MEX3A Antibody (NBP2-57357)

View related products by pathway.

Blogs on MEX3A

There are no specific blogs for MEX3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEX3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEX3A