METTL7B Antibody


Western Blot: METTL7B Antibody [NBP1-55180] - Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate.

Product Details

Product Discontinued
View other related METTL7B Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

METTL7B Antibody Summary

Synthetic peptides corresponding to METTL7B(methyltransferase like 7B) The peptide sequence was selected from the middle region of METTL7B. Peptide sequence FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against METTL7B and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for METTL7B Antibody

  • EC 2.1.1
  • EC 2.1.1.-
  • methyltransferase like 7B
  • methyltransferase-like protein 7B
  • MGC17301


METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for METTL7B Antibody (NBP1-55180) (0)

There are no publications for METTL7B Antibody (NBP1-55180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL7B Antibody (NBP1-55180) (0)

There are no reviews for METTL7B Antibody (NBP1-55180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for METTL7B Antibody (NBP1-55180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional METTL7B Products

Bioinformatics Tool for METTL7B Antibody (NBP1-55180)

Discover related pathways, diseases and genes to METTL7B Antibody (NBP1-55180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for METTL7B Antibody (NBP1-55180)

Discover more about diseases related to METTL7B Antibody (NBP1-55180).

Pathways for METTL7B Antibody (NBP1-55180)

View related products by pathway.

Blogs on METTL7B

There are no specific blogs for METTL7B, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our METTL7B Antibody and receive a gift card or discount.


Gene Symbol METTL7B