METTL4 Antibody

Images

 
Western Blot: METTL4 Antibody [NBP1-79301] - Rat Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Rt, Hu, Mu, Bv, Ca, Eq, Gp, Rb, Sh, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

METTL4 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human Mettl4The immunogen for this antibody is Mettl4. Peptide sequence SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Mouse (100%), Guinea Pig (100%), Zebrafish (93%), Rabbit (100%), Bovine (100%), Sheep (93%), Equine (100%), Canine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Mettl4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for METTL4 Antibody

  • EC 2.1.1.-
  • FLJ23017
  • HsT661
  • methyltransferase like 4
  • methyltransferase-like protein 4
  • MGC117235

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for METTL4 Antibody (NBP1-79301) (0)

There are no publications for METTL4 Antibody (NBP1-79301).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL4 Antibody (NBP1-79301) (0)

There are no reviews for METTL4 Antibody (NBP1-79301). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for METTL4 Antibody (NBP1-79301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional METTL4 Products

Bioinformatics Tool for METTL4 Antibody (NBP1-79301)

Discover related pathways, diseases and genes to METTL4 Antibody (NBP1-79301). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METTL4

There are no specific blogs for METTL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL4
Uniprot