METTL18 Antibody

Images

 
Western Blot: METTL18 Antibody [NBP1-88869] - Analysis in control (vector only transfected HEK293T lysate) and METTL18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: METTL18 Antibody [NBP1-88869] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: METTL18 Antibody [NBP1-88869] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: METTL18 Antibody [NBP1-88869] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related METTL18 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88869
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

METTL18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for METTL18 Antibody

  • Arsenic-transactivated protein 2
  • AsTP2ASTP2
  • C1orf156
  • chromosome 1 open reading frame 156
  • EC 2.1.1.-
  • methyltransferase like 18
  • Methyltransferase-like protein 18
  • MGC9084

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88869
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for METTL18 Antibody (NBP1-88869) (0)

There are no publications for METTL18 Antibody (NBP1-88869).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL18 Antibody (NBP1-88869) (0)

There are no reviews for METTL18 Antibody (NBP1-88869). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for METTL18 Antibody (NBP1-88869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional METTL18 Products

METTL18 NBP1-88869

Bioinformatics Tool for METTL18 Antibody (NBP1-88869)

Discover related pathways, diseases and genes to METTL18 Antibody (NBP1-88869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METTL18

There are no specific blogs for METTL18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL18