Recombinant Human Mesothelin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Mesothelin Peptides and Proteins

Order Details


    • Catalog Number
      H00010232-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Mesothelin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 464-563 of Human MSLN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWI

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
MSLN

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010232-Q01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mesothelin Protein

  • CAK1 antigen
  • CAK1
  • megakaryocyte potentiating factor
  • Mesothelin
  • MPF
  • MPFSMRP
  • MSLN
  • Pre-pro-megakaryocyte-potentiating factor
  • SMR
  • soluble MPF mesothelin related protein

Background

MSLN - mesothelin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Mesothelin Partial Recombinant Protein (H00010232-Q01)(1)

Reviews for Mesothelin Partial Recombinant Protein (H00010232-Q01) (0)

There are no reviews for Mesothelin Partial Recombinant Protein (H00010232-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mesothelin Partial Recombinant Protein (H00010232-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mesothelin Products

Bioinformatics Tool for Mesothelin Partial Recombinant Protein (H00010232-Q01)

Discover related pathways, diseases and genes to Mesothelin Partial Recombinant Protein (H00010232-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mesothelin Partial Recombinant Protein (H00010232-Q01)

Discover more about diseases related to Mesothelin Partial Recombinant Protein (H00010232-Q01).
 

Pathways for Mesothelin Partial Recombinant Protein (H00010232-Q01)

View related products by pathway.

PTMs for Mesothelin Partial Recombinant Protein (H00010232-Q01)

Learn more about PTMs related to Mesothelin Partial Recombinant Protein (H00010232-Q01).
 

Research Areas for Mesothelin Partial Recombinant Protein (H00010232-Q01)

Find related products by research area.

Blogs on Mesothelin

There are no specific blogs for Mesothelin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mesothelin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MSLN
Entrez