Recombinant Human Mer Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Mer Peptides and Proteins

Order Details


    • Catalog Number
      H00010461-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Mer Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-120 of Human MERTK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MERTK

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mer Protein

  • c-Eyk
  • c-mer proto-oncogene tyrosine kinase
  • C-mer
  • EC 2.7.10
  • EC 2.7.10.1
  • MER receptor tyrosine kinase
  • Mer
  • MerTK
  • MGC133349
  • Receptor tyrosine kinase MerTK
  • RP38Proto-oncogene c-Mer
  • STK kinase
  • tyrosine-protein kinase Mer

Background

MERTK - c-mer proto-oncogene tyrosine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
AF885
Species: Hu
Applications: WB, IHC
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NBP1-90096
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for Mer Partial Recombinant Protein (H00010461-Q01) (0)

There are no publications for Mer Partial Recombinant Protein (H00010461-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mer Partial Recombinant Protein (H00010461-Q01) (0)

There are no reviews for Mer Partial Recombinant Protein (H00010461-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mer Partial Recombinant Protein (H00010461-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mer Products

Bioinformatics Tool for Mer Partial Recombinant Protein (H00010461-Q01)

Discover related pathways, diseases and genes to Mer Partial Recombinant Protein (H00010461-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mer Partial Recombinant Protein (H00010461-Q01)

Discover more about diseases related to Mer Partial Recombinant Protein (H00010461-Q01).
 

Pathways for Mer Partial Recombinant Protein (H00010461-Q01)

View related products by pathway.

PTMs for Mer Partial Recombinant Protein (H00010461-Q01)

Learn more about PTMs related to Mer Partial Recombinant Protein (H00010461-Q01).
 

Research Areas for Mer Partial Recombinant Protein (H00010461-Q01)

Find related products by research area.

Blogs on Mer

There are no specific blogs for Mer, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mer Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MERTK
Entrez