Melanophilin Antibody


Western Blot: Melanophilin Antibody [NBP1-69185] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Product Discontinued
View other related Melanophilin Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Melanophilin Antibody Summary

Synthetic peptides corresponding to MLPH (melanophilin) The peptide sequence was selected from the C terminal of MLPH. Peptide sequence NLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MLPH and was validated on Western blot.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Melanophilin Antibody

  • exophilin-3
  • l(1)-3Rk
  • l1Rk3
  • ln
  • melanophilin
  • MGC2771
  • MGC59733
  • SLAC2A
  • Slac-2a
  • SLAC2-A
  • Slp homolog lacking C2 domains a
  • Synaptotagmin-like protein 2a


This gene encodes a member of the exophilin subfamily of Rab effector proteins. The protein forms a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. A similar protein complex in mouse functions to tether pigment-producing organelles called melanosomes to the actin cytoskeleton in melanocytes, and is required for visible pigmentation in the hair and skin. A mutation in this gene results in Griscelli syndrome type 3, which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Melanophilin Antibody (NBP1-69185) (0)

There are no publications for Melanophilin Antibody (NBP1-69185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanophilin Antibody (NBP1-69185) (0)

There are no reviews for Melanophilin Antibody (NBP1-69185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melanophilin Antibody (NBP1-69185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Melanophilin Products

Bioinformatics Tool for Melanophilin Antibody (NBP1-69185)

Discover related pathways, diseases and genes to Melanophilin Antibody (NBP1-69185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanophilin Antibody (NBP1-69185)

Discover more about diseases related to Melanophilin Antibody (NBP1-69185).

Pathways for Melanophilin Antibody (NBP1-69185)

View related products by pathway.

PTMs for Melanophilin Antibody (NBP1-69185)

Learn more about PTMs related to Melanophilin Antibody (NBP1-69185).

Blogs on Melanophilin

There are no specific blogs for Melanophilin, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Melanophilin Antibody and receive a gift card or discount.


Gene Symbol MLPH