MEKK1 Antibody (2F6)

Images

 
Sandwich ELISA: MEKK1 Antibody (2F6) [H00004214-M01] - Detection limit for recombinant GST tagged MAP3K1 is approximately 0.03ng/ml as a capture antibody.
Proximity Ligation Assay: MEKK1 Antibody (2F6) [H00004214-M01] - Analysis of protein-protein interactions between MAPK3 and MAP3K1. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEKK1 Antibody (2F6) Summary

Immunogen
MAP3K1 (XP_042066 1211 a.a. - 1310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
Localization
Cytoplasmic
Specificity
MAP3K1 - mitogen-activated protein kinase kinase kinase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEKK1 Antibody (2F6)

  • MAPK/ERK kinase kinase 1
  • MAPKKK1MAP/ERK kinase kinase 1
  • MEK kinase 1
  • MEKK1EC 2.7.11.25
  • MEKKMEKK 1
  • mitogen-activated protein kinase kinase kinase 1

Background

MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for MEKK1 Antibody (H00004214-M01) (0)

There are no publications for MEKK1 Antibody (H00004214-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK1 Antibody (H00004214-M01) (0)

There are no reviews for MEKK1 Antibody (H00004214-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK1 Antibody (H00004214-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEKK1 Products

Bioinformatics Tool for MEKK1 Antibody (H00004214-M01)

Discover related pathways, diseases and genes to MEKK1 Antibody (H00004214-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK1 Antibody (H00004214-M01)

Discover more about diseases related to MEKK1 Antibody (H00004214-M01).
 

Pathways for MEKK1 Antibody (H00004214-M01)

View related products by pathway.

PTMs for MEKK1 Antibody (H00004214-M01)

Learn more about PTMs related to MEKK1 Antibody (H00004214-M01).
 

Research Areas for MEKK1 Antibody (H00004214-M01)

Find related products by research area.

Blogs on MEKK1

There are no specific blogs for MEKK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK1 Antibody (2F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K1
Entrez
OMIM
Uniprot