MEK5 Antibody (1F6)

Images

 
Immunocytochemistry/ Immunofluorescence: MEK5 Antibody (1F6) [H00005607-M06] - Analysis of monoclonal antibody to MAP2K5 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Product Discontinued
View other related MEK5 Primary Antibodies

Order Details


    • Catalog Number
      H00005607-M06
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MEK5 Antibody (1F6) Summary

Immunogen
MAP2K5 (AAH08838, 1 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
Specificity
MAP2K5 - mitogen-activated protein kinase kinase 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP2K5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEK5 Antibody (1F6)

  • HsT17454
  • MAP kinase kinase 5
  • MAP kinase kinase MEK5b
  • MAP2K5
  • MAPK/ERK kinase 5
  • MAPKK 5
  • MAPKK5
  • MAPKK5EC 2.7.12.2
  • MEK5
  • MEK5MEK 5
  • mitogen-activated protein kinase kinase 5
  • MKK5
  • PRKMK5
  • PRKMK5dual specificity mitogen-activated protein kinase kinase 5

Background

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-24756
Species: Hu
Applications: WB, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB6095
Species: Hu
Applications: WB
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005607-M06
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MEK5 Antibody (H00005607-M06) (0)

There are no publications for MEK5 Antibody (H00005607-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEK5 Antibody (H00005607-M06) (0)

There are no reviews for MEK5 Antibody (H00005607-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEK5 Antibody (H00005607-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEK5 Products

Bioinformatics Tool for MEK5 Antibody (H00005607-M06)

Discover related pathways, diseases and genes to MEK5 Antibody (H00005607-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEK5 Antibody (H00005607-M06)

Discover more about diseases related to MEK5 Antibody (H00005607-M06).
 

Pathways for MEK5 Antibody (H00005607-M06)

View related products by pathway.

PTMs for MEK5 Antibody (H00005607-M06)

Learn more about PTMs related to MEK5 Antibody (H00005607-M06).
 

Research Areas for MEK5 Antibody (H00005607-M06)

Find related products by research area.

Blogs on MEK5

There are no specific blogs for MEK5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEK5 Antibody (1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2K5
Entrez
OMIM
Uniprot