MEIS1 Antibody

Images

 
Western Blot: MEIS1 Antibody [H00004211-B01P] - Analysis of MEIS1 expression in transfected 293T cell line by MEIS1 polyclonal antibody. Lane 1: MEIS1 transfected lysate(41.58 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEIS1 Antibody Summary

Immunogen
MEIS1 (AAH36511.1, 1 a.a. - 378 a.a.) full-length human protein. MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGKTLFLW
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MEIS1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.
Reviewed Applications
Read 1 Review rated 2
using
H00004211-B01P in the following application:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEIS1 Antibody

  • homeobox protein Meis1
  • leukemogenic homolog protein
  • Meis homeobox 1
  • MGC43380
  • myeloid ecotropic viral integration site 1 homolog (mouse)
  • myeloid ecotropic viral integration site 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBL1-11664
Species: Hu
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP2-31853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005090-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P

Publications for MEIS1 Antibody (H00004211-B01P) (0)

There are no publications for MEIS1 Antibody (H00004211-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MEIS1 Antibody (H00004211-B01P) (1) 21

Average Rating: 2
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00004211-B01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MEIS1 H00004211-B01P
Enlarge
reviewed by:
Anonymous
WB Human 12/01/2016
View

Summary

ApplicationWestern Blot
Sample TestedLNCaP human prostate cancer cell line
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEIS1 Antibody (H00004211-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEIS1 Products

Bioinformatics Tool for MEIS1 Antibody (H00004211-B01P)

Discover related pathways, diseases and genes to MEIS1 Antibody (H00004211-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEIS1 Antibody (H00004211-B01P)

Discover more about diseases related to MEIS1 Antibody (H00004211-B01P).
 

Pathways for MEIS1 Antibody (H00004211-B01P)

View related products by pathway.

PTMs for MEIS1 Antibody (H00004211-B01P)

Learn more about PTMs related to MEIS1 Antibody (H00004211-B01P).

Blogs on MEIS1

There are no specific blogs for MEIS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2
5
0
4
0
3
0
2
1
1
0

Anonymous
12/01/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol MEIS1