MEGT1 Antibody


Immunohistochemistry: MEGT1 Antibody [NBP2-30732] - Staining of human small intestine shows distinct positivity in erythrocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MEGT1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SDLDSPTSSLRRSPSLQSSGDRVGGRRDLSSPQGLLPGRPVQQRRGKPCGPCRHFGCSSYRPDLSLARTVERI
Specificity of human MEGT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEGT1 Protein (NBP2-30732PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MEGT1 Antibody

  • C6orf23
  • Chromosome 6 Open Reading Frame 23
  • G6D
  • LY6-D
  • LY6G6D
  • Lymphocyte Antigen 6 Complex Locus Protein G6d
  • Lymphocyte Antigen 6 Complex, Locus G6D
  • Lymphocyte Antigen-6 G6D
  • Megakaryocyte-Enhanced Gene Transcript 1 Protein
  • NG25
  • Protein Ly6-D


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB
Species: Hu, Mu
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MEGT1 Antibody (NBP2-30732) (0)

There are no publications for MEGT1 Antibody (NBP2-30732).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGT1 Antibody (NBP2-30732) (0)

There are no reviews for MEGT1 Antibody (NBP2-30732). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEGT1 Antibody (NBP2-30732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MEGT1 Products

MEGT1 NBP2-30732

Bioinformatics Tool for MEGT1 Antibody (NBP2-30732)

Discover related pathways, diseases and genes to MEGT1 Antibody (NBP2-30732). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEGT1 Antibody (NBP2-30732)

Discover more about diseases related to MEGT1 Antibody (NBP2-30732).

Pathways for MEGT1 Antibody (NBP2-30732)

View related products by pathway.

Blogs on MEGT1

There are no specific blogs for MEGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MEGT1 Antibody and receive a gift card or discount.


Gene Symbol LY6G6D