MEGT1 Antibody

Images

 
Immunohistochemistry: MEGT1 Antibody [NBP2-30732] - Staining of human small intestine shows distinct positivity in erythrocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEGT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SDLDSPTSSLRRSPSLQSSGDRVGGRRDLSSPQGLLPGRPVQQRRGKPCGPCRHFGCSSYRPDLSLARTVERI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LY6G6D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEGT1 Protein (NBP2-30732PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEGT1 Antibody

  • C6orf23
  • Chromosome 6 Open Reading Frame 23
  • G6D
  • LY6-D
  • LY6G6D
  • Lymphocyte Antigen 6 Complex Locus Protein G6d
  • Lymphocyte Antigen 6 Complex, Locus G6D
  • Lymphocyte Antigen-6 G6D
  • Megakaryocyte-Enhanced Gene Transcript 1 Protein
  • NG25
  • Protein Ly6-D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24505
Species: Hu, Pm
Applications: WB
NB600-1387
Species: Hu, Mu
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14208
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
1849-NK
Species: Hu
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92012
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP1-86092
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-91160
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MEGT1 Antibody (NBP2-30732) (0)

There are no publications for MEGT1 Antibody (NBP2-30732).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGT1 Antibody (NBP2-30732) (0)

There are no reviews for MEGT1 Antibody (NBP2-30732). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEGT1 Antibody (NBP2-30732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEGT1 Products

MEGT1 NBP2-30732

Bioinformatics Tool for MEGT1 Antibody (NBP2-30732)

Discover related pathways, diseases and genes to MEGT1 Antibody (NBP2-30732). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEGT1 Antibody (NBP2-30732)

Discover more about diseases related to MEGT1 Antibody (NBP2-30732).
 

Pathways for MEGT1 Antibody (NBP2-30732)

View related products by pathway.

Blogs on MEGT1

There are no specific blogs for MEGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEGT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6G6D
Uniprot