MED16 Antibody

Images

 
Immunohistochemistry-Paraffin: MED16 Antibody [NBP1-84054] - Staining of human liver shows moderate cytoplasmic positivity with a granular pattern in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MED16 Protein (NBP1-84054PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED16 Antibody

  • DRIP92thyroid hormone receptor associated protein 5
  • mediator complex subunit 16THRAP5
  • mediator of RNA polymerase II transcription subunit 16
  • Thyroid hormone receptor-associated protein 5
  • Thyroid hormone receptor-associated protein complex 95 kDa component
  • thyroid hormone receptor-associated protein, 95-kD subunit
  • TRAP95
  • Vitamin D3 receptor-interacting protein complex 92 kDa component

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74599
Species: Hu, Mu
Applications: WB, IP
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP1-87818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-81320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-84140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-31617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED16 Antibody (NBP1-84054) (0)

There are no publications for MED16 Antibody (NBP1-84054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED16 Antibody (NBP1-84054) (0)

There are no reviews for MED16 Antibody (NBP1-84054). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MED16 Antibody (NBP1-84054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED16 Products

Bioinformatics Tool for MED16 Antibody (NBP1-84054)

Discover related pathways, diseases and genes to MED16 Antibody (NBP1-84054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED16 Antibody (NBP1-84054)

Discover more about diseases related to MED16 Antibody (NBP1-84054).
 

Pathways for MED16 Antibody (NBP1-84054)

View related products by pathway.

Research Areas for MED16 Antibody (NBP1-84054)

Find related products by research area.

Blogs on MED16

There are no specific blogs for MED16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED16