MDR3/ABCB4 Antibody

Images

 
Western Blot: MDR3/ABCB4 Antibody [NBP1-59802] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Product Details

Summary
Product Discontinued
View other related MDR3/ABCB4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59802
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MDR3/ABCB4 Antibody Summary

Immunogen
Synthetic peptides corresponding to ABCB4(ATP-binding cassette, sub-family B (MDR/TAP), member 4) The peptide sequence was selected from the middle region of ABCB4. Peptide sequence GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV.
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ABCB4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MDR3/ABCB4 Antibody

  • ABC21
  • ABCB4
  • ATP-binding cassette sub-family B member 4
  • ATP-binding cassette, sub-family B (MDR/TAP), member 4
  • EC 3.6.3
  • EC 3.6.3.44
  • GBD1
  • MDR2
  • MDR3
  • MDR3MDR2/3
  • multidrug resistance protein 3
  • multiple drug resistance 3
  • P glycoprotein 3/multiple drug resistance 3
  • PFIC-3
  • P-glycoprotein 3
  • P-glycoprotein-3/multiple drug resistance-3
  • PGY3
  • PGY3GBD1

Background

ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Member

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46466
Species: Hu
Applications: IHC
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
46770002
Species: Hu
Applications: ELISA
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P

Publications for MDR3/ABCB4 Antibody (NBP1-59802) (0)

There are no publications for MDR3/ABCB4 Antibody (NBP1-59802).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDR3/ABCB4 Antibody (NBP1-59802) (0)

There are no reviews for MDR3/ABCB4 Antibody (NBP1-59802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDR3/ABCB4 Antibody (NBP1-59802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDR3/ABCB4 Products

Bioinformatics Tool for MDR3/ABCB4 Antibody (NBP1-59802)

Discover related pathways, diseases and genes to MDR3/ABCB4 Antibody (NBP1-59802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDR3/ABCB4 Antibody (NBP1-59802)

Discover more about diseases related to MDR3/ABCB4 Antibody (NBP1-59802).
 

Pathways for MDR3/ABCB4 Antibody (NBP1-59802)

View related products by pathway.

PTMs for MDR3/ABCB4 Antibody (NBP1-59802)

Learn more about PTMs related to MDR3/ABCB4 Antibody (NBP1-59802).

Blogs on MDR3/ABCB4

There are no specific blogs for MDR3/ABCB4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDR3/ABCB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB4
Entrez