MDR3/ABCB4 Antibody

Product Discontinued

MDR3/ABCB4 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ABCB4(ATP-binding cassette, sub-family B (MDR/TAP), member 4) The peptide sequence was selected from the middle region of ABCB4. Peptide sequence GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV.
• Predicted Species: Mouse (92%), Rat (100%), Canine (93%), Sheep (93%), Bovine (93%), Guinea Pig (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCB4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ABCB4 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MDR3/ABCB4 Antibody

• ABC21
• ABCB4
• ATP-binding cassette sub-family B member 4
• ATP-binding cassette, sub-family B (MDR/TAP), member 4
• EC 3.6.3
• EC 3.6.3.44
• GBD1
• MDR2
• MDR3
• MDR3MDR2/3
• multidrug resistance protein 3
• multiple drug resistance 3
• P glycoprotein 3/multiple drug resistance 3
• PFIC-3
• P-glycoprotein 3
• P-glycoprotein-3/multiple drug resistance-3
• PGY3
• PGY3GBD1

Background

ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Member

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCB4