MDH1B Antibody

Images

 
Immunohistochemistry-Paraffin: MDH1B Antibody [NBP1-83564] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts, Leydig cells showed moderate cytoplasmic staining.

Product Details

Summary
Product Discontinued
View other related MDH1B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83564
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MDH1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TTGRQFGGILAAHSIATTLKYWYHGSPPGEIVSLGILSEGQFGIPKGIVFSMPVKFENGTWVVLTDLKDVEISEQIMTRMTSDLIQEKLVALG
Specificity
Specificity of human MDH1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDH1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDH1B Antibody

  • EC 1.1.1.-
  • FLJ25341
  • malate dehydrogenase 1B, NAD (soluble)
  • putative malate dehydrogenase 1B
  • RP11-95H11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MDH1B Antibody (NBP1-83564) (0)

There are no publications for MDH1B Antibody (NBP1-83564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDH1B Antibody (NBP1-83564) (0)

There are no reviews for MDH1B Antibody (NBP1-83564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MDH1B Antibody (NBP1-83564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDH1B Products

Bioinformatics Tool for MDH1B Antibody (NBP1-83564)

Discover related pathways, diseases and genes to MDH1B Antibody (NBP1-83564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MDH1B Antibody (NBP1-83564)

Find related products by research area.

Blogs on MDH1B

There are no specific blogs for MDH1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDH1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDH1B